Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
Domain d4duwc1: 4duw C:9-219 [251596] Other proteins in same PDB: d4duwa2, d4duwa3, d4duwa4, d4duwa5, d4duwb2, d4duwb3, d4duwb4, d4duwb5, d4duwc2, d4duwc3, d4duwc4, d4duwc5, d4duwd2, d4duwd3, d4duwd4, d4duwd5 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 4duw (more details), 2.2 Å
SCOPe Domain Sequences for d4duwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duwc1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d4duwc1:
View in 3D Domains from same chain: (mouse over for more information) d4duwc2, d4duwc3, d4duwc4, d4duwc5 |