Lineage for d4duwc1 (4duw C:9-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775086Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2775125Domain d4duwc1: 4duw C:9-219 [251596]
    Other proteins in same PDB: d4duwa2, d4duwa3, d4duwa4, d4duwa5, d4duwb2, d4duwb3, d4duwb4, d4duwb5, d4duwc2, d4duwc3, d4duwc4, d4duwc5, d4duwd2, d4duwd3, d4duwd4, d4duwd5
    automated match to d1f49a3
    complexed with dms, mg, na

Details for d4duwc1

PDB Entry: 4duw (more details), 2.2 Å

PDB Description: e. coli (lacz) beta-galactosidase (g974a) in complex with allolactose
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d4duwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duwc1 b.18.1.0 (C:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d4duwc1:

Click to download the PDB-style file with coordinates for d4duwc1.
(The format of our PDB-style files is described here.)

Timeline for d4duwc1: