Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
Domain d4duwa3: 4duw A:334-625 [251588] Other proteins in same PDB: d4duwa1, d4duwa2, d4duwa4, d4duwa5, d4duwb1, d4duwb2, d4duwb4, d4duwb5, d4duwc1, d4duwc2, d4duwc4, d4duwc5, d4duwd1, d4duwd2, d4duwd4, d4duwd5 automated match to d1jz7a5 complexed with dms, mg, na |
PDB Entry: 4duw (more details), 2.2 Å
SCOPe Domain Sequences for d4duwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duwa3 c.1.8.0 (A:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d4duwa3:
View in 3D Domains from same chain: (mouse over for more information) d4duwa1, d4duwa2, d4duwa4, d4duwa5 |