Lineage for d2qila1 (2qil A:1-93)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 229053Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)
  7. 229054Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)
  8. 229063Domain d2qila1: 2qil A:1-93 [25157]
    Other proteins in same PDB: d2qila2, d2qilb2, d2qilc2

Details for d2qila1

PDB Entry: 2qil (more details), 2.07 Å

PDB Description: toxic shock syndrome toxin-1 at 2.07 a resolution

SCOP Domain Sequences for d2qila1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qila1 b.40.2.2 (A:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOP Domain Coordinates for d2qila1:

Click to download the PDB-style file with coordinates for d2qila1.
(The format of our PDB-style files is described here.)

Timeline for d2qila1: