Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins) |
Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50223] (8 PDB entries) |
Domain d1stea1: 1ste A:1-120 [25154] Other proteins in same PDB: d1stea2 complexed with zn |
PDB Entry: 1ste (more details), 2 Å
SCOP Domain Sequences for d1stea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1stea1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]} esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
Timeline for d1stea1: