SCOP 1.75: Domain d1stea1: 1ste A:1-120

Lineage for d1stea1 (1ste A:1-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)

6. Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50223] (8 PDB entries)

8. Domain d1stea1: 1ste A:1-120 [25154]
   Other proteins in same PDB: d1stea2
   complexed with zn

Details for d1stea1

PDB Entry: 1ste, 2 Å

PDB Description: staphylococcal enterotoxin c2 from staphylococcus aureus

PDB Compounds: (A:) staphylococcal enterotoxin c2

SCOP Domain Sequences for d1stea1:

Sequence; same for both SEQRES and ATOM records:

>d1stea1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Timeline for d1stea1:

• d1stea1 first appeared (with stable ids) in SCOP 1.55, called d1ste_1
  
• d1stea1 appears in SCOP 1.73
  
• d1stea1 appears in SCOPe 2.01
  
• d1stea1 appears in the current release, SCOPe 2.08