Lineage for d4dqna_ (4dqn A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2248742Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2248743Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2248862Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2248863Protein automated matches [190815] (13 species)
    not a true protein
  7. 2248909Species Streptococcus mutans [TaxId:1309] [256238] (1 PDB entry)
  8. 2248910Domain d4dqna_: 4dqn A: [251532]
    automated match to d3ht5a_

Details for d4dqna_

PDB Entry: 4dqn (more details), 1.97 Å

PDB Description: Crystal structure of the branched-chain aminotransferase from Streptococcus mutans
PDB Compounds: (A:) Putative branched-chain amino acid aminotransferase IlvE

SCOPe Domain Sequences for d4dqna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dqna_ e.17.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
tvdldwknlgfeyhklpfryisyykdgkwddgkltedatlhisesspalhygqeafeglk
ayrtkdgsvqlfrpnmnaerlqrtadrllmpqvptdkfidaakqvvraneeyvppygtga
tlylrplligvgdvigvhpadeyiftifampvgnyfkgglaptnfliqddydraaphgtg
aakvggnyaasllpgkvaherqfsdviyldpathtkieevgsanffgitkdnefitplsp
silpsvtkysllylaehrfgmkaiegdvcvdeldkfveagacgtaavispiggvqhgddf
hvfysetevgpvthklydeltgiqfgdvkapegwiykvdd

SCOPe Domain Coordinates for d4dqna_:

Click to download the PDB-style file with coordinates for d4dqna_.
(The format of our PDB-style files is described here.)

Timeline for d4dqna_: