Lineage for d1i4hb1 (1i4h B:8-120)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540834Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1540844Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)
  7. 1540845Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)
  8. 1540853Domain d1i4hb1: 1i4h B:8-120 [25153]
    Other proteins in same PDB: d1i4ha2, d1i4hb2
    complexed with zn; mutant

Details for d1i4hb1

PDB Entry: 1i4h (more details), 2.9 Å

PDB Description: crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a
PDB Compounds: (B:) enterotoxin type a

SCOPe Domain Sequences for d1i4hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4hb1 b.40.2.2 (B:8-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
nekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndl
lvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

SCOPe Domain Coordinates for d1i4hb1:

Click to download the PDB-style file with coordinates for d1i4hb1.
(The format of our PDB-style files is described here.)

Timeline for d1i4hb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4hb2