SCOP 1.63: Domain d1i4hb1: 1i4h B:8-120

Lineage for d1i4hb1 (1i4h B:8-120)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)

8. Domain d1i4hb1: 1i4h B:8-120 [25153]
   Other proteins in same PDB: d1i4ha2, d1i4hb2
   complexed with zn; mutant

Details for d1i4hb1

PDB Entry: 1i4h, 2.9 Å

PDB Description: crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a

SCOP Domain Sequences for d1i4hb1:

Sequence; same for both SEQRES and ATOM records:

>d1i4hb1 b.40.2.2 (B:8-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
nekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndl
lvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Timeline for d1i4hb1:

• d1i4hb1 first appeared (with stable ids) in SCOP 1.55
  
• d1i4hb1 appears in SCOP 1.61
  
• d1i4hb1 appears in SCOP 1.65
  
• d1i4hb1 appears in the current release, SCOPe 2.08