Lineage for d4dnqj_ (4dnq J:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1618000Species Petunia hybrida [TaxId:4102] [256236] (2 PDB entries)
  8. 1618011Domain d4dnqj_: 4dnq J: [251521]
    automated match to d1woma_
    mutant

Details for d4dnqj_

PDB Entry: 4dnq (more details), 2.8 Å

PDB Description: Crystal Structure of DAD2 S96A mutant
PDB Compounds: (J:) dad2

SCOPe Domain Sequences for d4dnqj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dnqj_ c.69.1.0 (J:) automated matches {Petunia hybrida [TaxId: 4102]}
qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
fdfrryttldpyvddllhildalgidccayvghavsamigilasirrpelfskliligas
prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
ieghlphlsaptllaqelrrals

SCOPe Domain Coordinates for d4dnqj_:

Click to download the PDB-style file with coordinates for d4dnqj_.
(The format of our PDB-style files is described here.)

Timeline for d4dnqj_: