SCOP 1.61: Domain d1sxtb1: 1sxt B:10-120

Lineage for d1sxtb1 (1sxt B:10-120)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50221] (5 PDB entries)

8. Domain d1sxtb1: 1sxt B:10-120 [25151]
   Other proteins in same PDB: d1sxta2, d1sxtb2

Details for d1sxtb1

PDB Entry: 1sxt, 2.7 Å

PDB Description: staphylococcal enterotoxin type a (sea) co-crystallised with zinc

SCOP Domain Sequences for d1sxtb1:

Sequence, based on SEQRES records:

>d1sxtb1 b.40.2.2 (B:10-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Sequence, based on observed residues (ATOM records):

>d1sxtb1 b.40.2.2 (B:10-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
dfdskdivdkykgkkvdlygayygyqcanktacmyggvtlhdnnrlt

Timeline for d1sxtb1:

• d1sxtb1 first appeared (with stable ids) in SCOP 1.55
  
• d1sxtb1 appears in SCOP 1.59
  
• d1sxtb1 appears in SCOP 1.63
  
• d1sxtb1 appears in the current release, SCOPe 2.08