SCOPe 2.04: Domain d4dnob_: 4dno B:

Lineage for d4dnob_ (4dno B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (56 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208963] [255906] (13 PDB entries)

8. Domain d4dnob_: 4dno B: [251508]
   automated match to d4io0a_
   complexed with he2; mutant

Details for d4dnob_

PDB Entry: 4dno, 1.95 Å

PDB Description: crystal structure of the cftr inhibitory factor cif with the e153q mutation adducted with the 1,2-epoxyhexane hydrolysis intermediate

PDB Compounds: (B:) Putative hydrolase

SCOPe Domain Sequences for d4dnob_:

Sequence; same for both SEQRES and ATOM records:

>d4dnob_ c.69.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr

Timeline for d4dnob_:

• d4dnob_ is new in SCOPe 2.04-stable
  
• d4dnob_ appears in SCOPe 2.05
  
• d4dnob_ appears in the current release, SCOPe 2.08