SCOPe 2.08: Domain d4dneb_: 4dne B:

Lineage for d4dneb_ (4dne B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d4dneb_: 4dne B: [251502]
   automated match to d4ekva_
   complexed with dtb, so4; mutant

Details for d4dneb_

PDB Entry: 4dne, 1.88 Å

PDB Description: crystal structure of a triple-mutant of streptavidin in complex with desthiobiotin

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d4dneb_:

Sequence; same for both SEQRES and ATOM records:

>d4dneb_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyvtargnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

Timeline for d4dneb_:

• d4dneb_ first appeared in SCOPe 2.04
  
• d4dneb_ appears in SCOPe 2.07