Lineage for d1i4gb1 (1i4g B:8-120)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110417Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 110418Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)
  7. 110419Species Staphylococcus aureus [TaxId:1280] [50221] (5 PDB entries)
  8. 110423Domain d1i4gb1: 1i4g B:8-120 [25149]
    Other proteins in same PDB: d1i4ga2, d1i4gb2

Details for d1i4gb1

PDB Entry: 1i4g (more details), 2.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity

SCOP Domain Sequences for d1i4gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4gb1 b.40.2.2 (B:8-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
nekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndl
lvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

SCOP Domain Coordinates for d1i4gb1:

Click to download the PDB-style file with coordinates for d1i4gb1.
(The format of our PDB-style files is described here.)

Timeline for d1i4gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4gb2