Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208963] [255906] (33 PDB entries) |
Domain d4dm7a1: 4dm7 A:25-319 [251481] Other proteins in same PDB: d4dm7a2, d4dm7c2 automated match to d4io0a_ mutant |
PDB Entry: 4dm7 (more details), 1.36 Å
SCOPe Domain Sequences for d4dm7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dm7a1 c.69.1.0 (A:25-319) automated matches {Pseudomonas aeruginosa [TaxId: 208963]} aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa diarlvymdapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgr
Timeline for d4dm7a1:
View in 3D Domains from other chains: (mouse over for more information) d4dm7b_, d4dm7c1, d4dm7c2, d4dm7d_ |