Lineage for d1esfb1 (1esf B:1-120)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 374369Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 374370Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)
  7. 374371Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)
  8. 374375Domain d1esfb1: 1esf B:1-120 [25147]
    Other proteins in same PDB: d1esfa2, d1esfb2
    complexed with cd

Details for d1esfb1

PDB Entry: 1esf (more details), 1.9 Å

PDB Description: staphylococcal enterotoxin a

SCOP Domain Sequences for d1esfb1:

Sequence, based on SEQRES records: (download)

>d1esfb1 b.40.2.2 (B:1-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Sequence, based on observed residues (ATOM records): (download)

>d1esfb1 b.40.2.2 (B:1-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgffyn
dllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

SCOP Domain Coordinates for d1esfb1:

Click to download the PDB-style file with coordinates for d1esfb1.
(The format of our PDB-style files is described here.)

Timeline for d1esfb1:

Domains from same chain:
(mouse over for more information)
d1esfb2
Domains from other chains:
(mouse over for more information)
d1esfa1, d1esfa2