SCOP 1.65: Domain d1esfb1: 1esf B:1-120

Lineage for d1esfb1 (1esf B:1-120)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)

8. Domain d1esfb1: 1esf B:1-120 [25147]
   Other proteins in same PDB: d1esfa2, d1esfb2
   complexed with cd

Details for d1esfb1

PDB Entry: 1esf, 1.9 Å

PDB Description: staphylococcal enterotoxin a

SCOP Domain Sequences for d1esfb1:

Sequence, based on SEQRES records:

>d1esfb1 b.40.2.2 (B:1-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Sequence, based on observed residues (ATOM records):

>d1esfb1 b.40.2.2 (B:1-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgffyn
dllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Timeline for d1esfb1:

• d1esfb1 first appeared (with stable ids) in SCOP 1.55
  
• d1esfb1 appears in SCOP 1.63
  
• d1esfb1 appears in SCOP 1.67
  
• d1esfb1 appears in the current release, SCOPe 2.08