SCOPe 2.05: Domain d4dhgd1: 4dhg D:-17-133

Lineage for d4dhgd1 (4dhg D:-17-133)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Thermobispora bispora [TaxId:469371] [233840] (3 PDB entries)

8. Domain d4dhgd1: 4dhg D:-17-133 [251455]
   Other proteins in same PDB: d4dhga2, d4dhgb2, d4dhgc2, d4dhgd2
   automated match to d3vc6a1
   complexed with gol, iod, po4, unl

Details for d4dhgd1

PDB Entry: 4dhg, 1.9 Å

PDB Description: crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833, an open loop conformation

PDB Compounds: (D:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d4dhgd1:

Sequence, based on SEQRES records:

>d4dhgd1 d.54.1.0 (D:-17-133) automated matches {Thermobispora bispora [TaxId: 469371]}
hhhssgvdlgtenlyfqsmlirevrvtpvafrdppllnaagvhqpwalrtivevvtdegi
tglgetygdlahleqvraaaarlpgldvyalhriyrrvadvvganivtdmhgltgsssrv
ktvdrvfaafevacldiqgkaagrpvadllg

Sequence, based on observed residues (ATOM records):

>d4dhgd1 d.54.1.0 (D:-17-133) automated matches {Thermobispora bispora [TaxId: 469371]}
hhhssgvdlgtenlyfqsmlirevrvtpvafrdppllnaagvhqpwalrtivevvtdegi
tglgetygdlahleqvraaaarlpgldvyalhriyrrvadvvganivsrvktvdrvfaaf
evacldiqgkaagrpvadllg

Timeline for d4dhgd1:

• d4dhgd1 first appeared in SCOPe 2.04
  
• d4dhgd1 appears in SCOPe 2.06
  
• d4dhgd1 appears in the current release, SCOPe 2.08