Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Thermobispora bispora [TaxId:469371] [233840] (3 PDB entries) |
Domain d4dhga1: 4dhg A:1-133 [251449] Other proteins in same PDB: d4dhga2, d4dhga3, d4dhgb2, d4dhgb3, d4dhgc2, d4dhgc3, d4dhgd2, d4dhgd3 automated match to d3vc6a1 complexed with gol, iod, po4, unl |
PDB Entry: 4dhg (more details), 1.9 Å
SCOPe Domain Sequences for d4dhga1:
Sequence, based on SEQRES records: (download)
>d4dhga1 d.54.1.0 (A:1-133) automated matches {Thermobispora bispora [TaxId: 469371]} mlirevrvtpvafrdppllnaagvhqpwalrtivevvtdegitglgetygdlahleqvra aaarlpgldvyalhriyrrvadvvganivtdmhgltgsssrvktvdrvfaafevacldiq gkaagrpvadllg
>d4dhga1 d.54.1.0 (A:1-133) automated matches {Thermobispora bispora [TaxId: 469371]} mlirevrvtpvafrdppllnaagvhqpwalrtivevvtdegitglgetygdlahleqvra aaarlpgldvyalhriyrrvadvvganivssrvktvdrvfaafevacldiqgkaagrpva dllg
Timeline for d4dhga1: