Lineage for d4dgxa2 (4dgx A:111-218)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1662297Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1662298Protein automated matches [190561] (3 species)
    not a true protein
  7. 1662299Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)
  8. 1662318Domain d4dgxa2: 4dgx A:111-218 [251447]
    Other proteins in same PDB: d4dgxa3
    automated match to d2shpa3
    mutant

Details for d4dgxa2

PDB Entry: 4dgx (more details), 2.3 Å

PDB Description: LEOPARD Syndrome-Associated SHP2/Y279C mutant
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4dgxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgxa2 d.93.1.0 (A:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

SCOPe Domain Coordinates for d4dgxa2:

Click to download the PDB-style file with coordinates for d4dgxa2.
(The format of our PDB-style files is described here.)

Timeline for d4dgxa2: