SCOP 1.63: Domain d1ptof_: 1pto F:

Lineage for d1ptof_ (1pto F:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Pertussis toxin S5 subunit [50217] (1 species)

7. Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries)

8. Domain d1ptof_: 1pto F: [25144]
   Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptod_, d1ptoe_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptoj_, d1ptok_

Details for d1ptof_

PDB Entry: 1pto, 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding

SCOP Domain Sequences for d1ptof_:

Sequence; same for both SEQRES and ATOM records:

>d1ptof_ b.40.2.1 (F:) Pertussis toxin S5 subunit {Bordetella pertussis}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce

Timeline for d1ptof_:

• d1ptof_ first appeared (with stable ids) in SCOP 1.55
  
• d1ptof_ appears in SCOP 1.61
  
• d1ptof_ appears in SCOP 1.65
  
• d1ptof_ appears in the current release, SCOPe 2.08