Lineage for d1bcpf_ (1bcp F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788577Protein Pertussis toxin S5 subunit [50217] (1 species)
  7. 2788578Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries)
  8. 2788581Domain d1bcpf_: 1bcp F: [25142]
    Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpj_, d1bcpk_
    complexed with atp

Details for d1bcpf_

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp
PDB Compounds: (F:) pertussis toxin

SCOPe Domain Sequences for d1bcpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcpf_ b.40.2.1 (F:) Pertussis toxin S5 subunit {Bordetella pertussis [TaxId: 520]}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce

SCOPe Domain Coordinates for d1bcpf_:

Click to download the PDB-style file with coordinates for d1bcpf_.
(The format of our PDB-style files is described here.)

Timeline for d1bcpf_: