Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Idiomarina loihiensis [TaxId:283942] [256232] (1 PDB entry) |
Domain d4dejg2: 4dej G:89-207 [251418] Other proteins in same PDB: d4deja1, d4deja3, d4dejb1, d4dejb3, d4dejc1, d4dejc3, d4dejd1, d4dejd3, d4deje1, d4deje3, d4dejf1, d4dejg1, d4dejg3, d4dejh1, d4dejh3, d4deji1, d4deji3, d4dejj1, d4dejj3, d4dejk1, d4dejk3, d4dejl1 automated match to d4hoja2 |
PDB Entry: 4dej (more details), 2.9 Å
SCOPe Domain Sequences for d4dejg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dejg2 a.45.1.0 (G:89-207) automated matches {Idiomarina loihiensis [TaxId: 283942]} lmpvypvargtsrlmmyrierdwyslaekiqkndaqarqelkegilslapifadtpyfms eefslvdcylapllwrlpaygidlegqgakeikqymvrlferktfqdslteeekelarn
Timeline for d4dejg2:
View in 3D Domains from other chains: (mouse over for more information) d4deja1, d4deja2, d4deja3, d4dejb1, d4dejb2, d4dejb3, d4dejc1, d4dejc2, d4dejc3, d4dejd1, d4dejd2, d4dejd3, d4deje1, d4deje2, d4deje3, d4dejf1, d4dejf2, d4dejh1, d4dejh2, d4dejh3, d4deji1, d4deji2, d4deji3, d4dejj1, d4dejj2, d4dejj3, d4dejk1, d4dejk2, d4dejk3, d4dejl1, d4dejl2 |