SCOP 1.65: Domain d1prtl_: 1prt L:

Lineage for d1prtl_ (1prt L:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Pertussis toxin S5 subunit [50217] (1 species)

7. Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries)

8. Domain d1prtl_: 1prt L: [25141]
   Other proteins in same PDB: d1prta_, d1prtb1, d1prtb2, d1prtc1, d1prtc2, d1prtd_, d1prte_, d1prtg_, d1prth1, d1prth2, d1prti1, d1prti2, d1prtj_, d1prtk_

Details for d1prtl_

PDB Entry: 1prt, 2.9 Å

PDB Description: the crystal structure of pertussis toxin

SCOP Domain Sequences for d1prtl_:

Sequence; same for both SEQRES and ATOM records:

>d1prtl_ b.40.2.1 (L:) Pertussis toxin S5 subunit {Bordetella pertussis}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce

Timeline for d1prtl_:

• d1prtl_ first appeared (with stable ids) in SCOP 1.55
  
• d1prtl_ appears in SCOP 1.63
  
• d1prtl_ appears in SCOP 1.67
  
• d1prtl_ appears in the current release, SCOPe 2.08