Lineage for d1prtf_ (1prt F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13812Protein Pertussis toxin S5 subunit [50217] (1 species)
  7. 13813Species Bordetella pertussis [TaxId:520] [50218] (3 PDB entries)
  8. 13814Domain d1prtf_: 1prt F: [25140]
    Other proteins in same PDB: d1prta_, d1prtb1, d1prtb2, d1prtc1, d1prtc2, d1prtd_, d1prte_, d1prtg_, d1prth1, d1prth2, d1prti1, d1prti2, d1prtj_, d1prtk_

Details for d1prtf_

PDB Entry: 1prt (more details), 2.9 Å

PDB Description: the crystal structure of pertussis toxin

SCOP Domain Sequences for d1prtf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prtf_ b.40.2.1 (F:) Pertussis toxin S5 subunit {Bordetella pertussis}
lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
sayalksrialtvedspypgtpgdllelqicplngyce

SCOP Domain Coordinates for d1prtf_:

Click to download the PDB-style file with coordinates for d1prtf_.
(The format of our PDB-style files is described here.)

Timeline for d1prtf_: