Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (16 species) |
Species Human (Homo sapiens) [TaxId:9606] [142220] (2 PDB entries) |
Domain d4dcnb_: 4dcn B: [251399] Other proteins in same PDB: d4dcnc_, d4dcnd_ automated match to d1mr3f_ complexed with gnp, mg |
PDB Entry: 4dcn (more details), 3.01 Å
SCOPe Domain Sequences for d4dcnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dcnb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens) [TaxId: 9606]} tremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggltsi rpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqam tssemanslglpalkdrkwqifktsatkgtgldeamewlvetlks
Timeline for d4dcnb_: