![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
![]() | Protein Pertussis toxin S4 subunit [50215] (1 species) |
![]() | Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries) |
![]() | Domain d1ptok_: 1pto K: [25139] Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptof_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptol_ complexed with gal, sia |
PDB Entry: 1pto (more details), 3.5 Å
SCOP Domain Sequences for d1ptok_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptok_ b.40.2.1 (K:) Pertussis toxin S4 subunit {Bordetella pertussis} dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
Timeline for d1ptok_: