Lineage for d1ptok_ (1pto K:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) 
Protein Pertussis toxin S4 subunit [50215] (1 species) Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries) 
Domain d1ptok_: 1pto K: [25139]
Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptof_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptol_
Details for d1ptok_
PDB Entry: 1pto (more details), 3.5 Å
PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding
SCOP Domain Sequences for d1ptok_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptok_ b.40.2.1 (K:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
SCOP Domain Coordinates for d1ptok_:
Click to download the PDB-style file with coordinates for d1ptok_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ptok_:
- d1ptok_ appears in SCOP 1.57
- d1ptok_ appears in the current release, SCOPe 2.08
View in 3D
