SCOPe 2.08: Domain d4d8fc1: 4d8f C:1-318

Lineage for d4d8fc1 (4d8f C:1-318)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (12 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:813] [225098] (5 PDB entries)

8. Domain d4d8fc1: 4d8f C:1-318 [251383]
   Other proteins in same PDB: d4d8fa2, d4d8fb2, d4d8fc2, d4d8fd2
   automated match to d2ania_
   complexed with acy, fe, mn

Details for d4d8fc1

PDB Entry: 4d8f, 2.2 Å

PDB Description: chlamydia trachomatis nrdb with a mn/fe cofactor (procedure 1 - high mn)

PDB Compounds: (C:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4d8fc1:

Sequence; same for both SEQRES and ATOM records:

>d4d8fc1 a.25.1.2 (C:1-318) automated matches {Chlamydia trachomatis [TaxId: 813]}
mqadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgk
dielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafee
avhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqe
fvknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidling
ikeenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrl
eriglkpiyhtknpfpwm

Timeline for d4d8fc1:

• d4d8fc1 first appeared in SCOPe 2.04, called d4d8fc_
  
• d4d8fc1 appears in SCOPe 2.07