SCOPe 2.06: Domain d4co8a1: 4co8 A:338-434

Lineage for d4co8a1 (4co8 A:338-434)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (16 PDB entries)

8. Domain d4co8a1: 4co8 A:338-434 [251374]
   Other proteins in same PDB: d4co8a2
   automated match to d1awca_
   complexed with edo

Details for d4co8a1

PDB Entry: 4co8, 1.05 Å

PDB Description: structure of the dna binding ets domain of human etv4

PDB Compounds: (A:) ets translocation variant 4

SCOPe Domain Sequences for d4co8a1:

Sequence; same for both SEQRES and ATOM records:

>d4co8a1 a.4.5.0 (A:338-434) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgalqlwqflvallddptnahfiawtgrgmefkliepeevarlwgiqknrpamnydklsr
slryyyekgimqkvageryvykfvcepealfslafpd

Timeline for d4co8a1:

• d4co8a1 first appeared in SCOPe 2.04, called d4co8a_
  
• d4co8a1 was called d4co8a_ in SCOPe 2.05
  
• d4co8a1 appears in SCOPe 2.07
  
• d4co8a1 appears in the current release, SCOPe 2.08