SCOP 1.65: Domain d1ptoe_: 1pto E:

Lineage for d1ptoe_ (1pto E:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Pertussis toxin S4 subunit [50215] (1 species)

7. Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)

8. Domain d1ptoe_: 1pto E: [25137]
   Other proteins in same PDB: d1ptoa_, d1ptob1, d1ptob2, d1ptoc1, d1ptoc2, d1ptof_, d1ptog_, d1ptoh1, d1ptoh2, d1ptoi1, d1ptoi2, d1ptol_

Details for d1ptoe_

PDB Entry: 1pto, 3.5 Å

PDB Description: the structure of a pertussis toxin-sugar complex as a model for receptor binding

SCOP Domain Sequences for d1ptoe_:

Sequence; same for both SEQRES and ATOM records:

>d1ptoe_ b.40.2.1 (E:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

Timeline for d1ptoe_:

• d1ptoe_ first appeared (with stable ids) in SCOP 1.55
  
• d1ptoe_ appears in SCOP 1.63
  
• d1ptoe_ appears in SCOP 1.67
  
• d1ptoe_ appears in the current release, SCOPe 2.08