Lineage for d4cd5a_ (4cd5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832513Species Cellvibrio japonicus [TaxId:498211] [256228] (2 PDB entries)
  8. 2832514Domain d4cd5a_: 4cd5 A: [251369]
    automated match to d1gw1a_
    complexed with bma, mvl, na

Details for d4cd5a_

PDB Entry: 4cd5 (more details), 1.1 Å

PDB Description: the structure of gh26 beta-mannanase cjman26c from cellvibrio japonicus in complex with manmim
PDB Compounds: (A:) endo-1,4-beta mannanase, putative, man26c

SCOPe Domain Sequences for d4cd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cd5a_ c.1.8.0 (A:) automated matches {Cellvibrio japonicus [TaxId: 498211]}
lpalidtqataetralyrnlaklrykhllfghedslaygvhwegdmdrsdvrdvtganpa
vygwelgglelghtanldavnfekmqhwikagysrggvitiswhvfnpvsggnswdktpa
vhelipggarhatlkayldtfvafnegladvdaqgnkhyppiifrpwhehngdwfwwgkg
haseqdyialwrftvhylrdekklrnliyayspdrsridmanfeagylygypgdayvdii
gldnywdvgheantasadeqkaaltaslkqlvqiarskgkiaaltetgnnrltidnfwte
rllgpisadadaseiayvmvwrnanlarekseqffapfpgqataddfkrfyqsevvlfed
elpplyr

SCOPe Domain Coordinates for d4cd5a_:

Click to download the PDB-style file with coordinates for d4cd5a_.
(The format of our PDB-style files is described here.)

Timeline for d4cd5a_: