SCOPe 2.08: Domain d4cd1a1: 4cd1 A:38-178

Lineage for d4cd1a1 (4cd1 A:38-178)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256210] (6 PDB entries)

8. Domain d4cd1a1: 4cd1 A:38-178 [251364]
   Other proteins in same PDB: d4cd1a2
   automated match to d3cj7a1
   complexed with 8e9

Details for d4cd1a1

PDB Entry: 4cd1, 2 Å

PDB Description: RnNTPDase2 in complex with PSB-071

PDB Compounds: (A:) Ectonucleoside triphosphate diphosphohydrolase 2

SCOPe Domain Sequences for d4cd1a1:

Sequence; same for both SEQRES and ATOM records:

>d4cd1a1 c.55.1.0 (A:38-178) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lkygivldagsshtsmfvykwpadkendtgivgqhsscdvqgggissyandpskagqslv
rcleqalrdvprdrhastplylgatagmrllnltspeatarvleavtqtltqypfdfrga
rilsgqdegvfgwvtanylle

Timeline for d4cd1a1:

• d4cd1a1 first appeared in SCOPe 2.04
  
• d4cd1a1 appears in SCOPe 2.07