SCOPe 2.06: Domain d4c51b2: 4c51 B:433-740

Lineage for d4c51b2 (4c51 B:433-740)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (11 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [228914] (2 PDB entries)

8. Domain d4c51b2: 4c51 B:433-740 [251342]
   automated match to d4c50a2
   complexed with glc, hem; mutant

Details for d4c51b2

PDB Entry: 4c51, 3.1 Å

PDB Description: crystal structure of the catalase-peroxidase (katg) r418l mutant from mycobacterium tuberculosis

PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d4c51b2:

Sequence; same for both SEQRES and ATOM records:

>d4c51b2 a.93.1.0 (B:433-740) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
kqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgga
nggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaai
ekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlld
kanlltlsapemtvlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepsp
addgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvm
nldrfdvr

Timeline for d4c51b2:

• d4c51b2 first appeared in SCOPe 2.04
  
• d4c51b2 appears in SCOPe 2.05
  
• d4c51b2 appears in SCOPe 2.07
  
• d4c51b2 appears in the current release, SCOPe 2.08