Lineage for d1bcpj_ (1bcp J:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398190Protein Pertussis toxin S4 subunit [50215] (1 species)
  7. 2398191Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)
  8. 2398198Domain d1bcpj_: 1bcp J: [25134]
    Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpf_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpl_
    complexed with atp

Details for d1bcpj_

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp
PDB Compounds: (J:) pertussis toxin

SCOPe Domain Sequences for d1bcpj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcpj_ b.40.2.1 (J:) Pertussis toxin S4 subunit {Bordetella pertussis [TaxId: 520]}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

SCOPe Domain Coordinates for d1bcpj_:

Click to download the PDB-style file with coordinates for d1bcpj_.
(The format of our PDB-style files is described here.)

Timeline for d1bcpj_: