SCOP 1.65: Domain d1bcpj_: 1bcp J:

Lineage for d1bcpj_ (1bcp J:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Pertussis toxin S4 subunit [50215] (1 species)

7. Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)

8. Domain d1bcpj_: 1bcp J: [25134]
   Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpf_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpl_

Details for d1bcpj_

PDB Entry: 1bcp, 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpj_:

Sequence; same for both SEQRES and ATOM records:

>d1bcpj_ b.40.2.1 (J:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

Timeline for d1bcpj_:

• d1bcpj_ first appeared (with stable ids) in SCOP 1.55
  
• d1bcpj_ appears in SCOP 1.63
  
• d1bcpj_ appears in SCOP 1.67
  
• d1bcpj_ appears in the current release, SCOPe 2.08