Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) automatically mapped to Pfam PF01194 |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
Protein automated matches [190336] (6 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:764097] [256224] (1 PDB entry) |
Domain d4c3ij_: 4c3i J: [251336] Other proteins in same PDB: d4c3ia_, d4c3ib_, d4c3ie1, d4c3ie2, d4c3if_, d4c3ig1, d4c3ih_, d4c3ii1, d4c3ii2, d4c3ik_, d4c3il_, d4c3im_, d4c3in_ automated match to d1twfj_ complexed with mg, mpd, so4, zn |
PDB Entry: 4c3i (more details), 3 Å
SCOPe Domain Sequences for d4c3ij_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c3ij_ a.4.11.1 (J:) automated matches {Saccharomyces cerevisiae [TaxId: 764097]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynplekr
Timeline for d4c3ij_: