Lineage for d1bcpd_ (1bcp D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59003Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 59173Protein Pertussis toxin S4 subunit [50215] (1 species)
  7. 59174Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)
  8. 59179Domain d1bcpd_: 1bcp D: [25132]
    Other proteins in same PDB: d1bcpa_, d1bcpb1, d1bcpb2, d1bcpc1, d1bcpc2, d1bcpf_, d1bcpg_, d1bcph1, d1bcph2, d1bcpi1, d1bcpi2, d1bcpl_

Details for d1bcpd_

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcpd_ b.40.2.1 (D:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

SCOP Domain Coordinates for d1bcpd_:

Click to download the PDB-style file with coordinates for d1bcpd_.
(The format of our PDB-style files is described here.)

Timeline for d1bcpd_: