Lineage for d1prtk_ (1prt K:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 296866Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 297076Protein Pertussis toxin S4 subunit [50215] (1 species)
  7. 297077Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)
  8. 297081Domain d1prtk_: 1prt K: [25131]
    Other proteins in same PDB: d1prta_, d1prtb1, d1prtb2, d1prtc1, d1prtc2, d1prtf_, d1prtg_, d1prth1, d1prth2, d1prti1, d1prti2, d1prtl_

Details for d1prtk_

PDB Entry: 1prt (more details), 2.9 Å

PDB Description: the crystal structure of pertussis toxin

SCOP Domain Sequences for d1prtk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prtk_ b.40.2.1 (K:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

SCOP Domain Coordinates for d1prtk_:

Click to download the PDB-style file with coordinates for d1prtk_.
(The format of our PDB-style files is described here.)

Timeline for d1prtk_: