SCOP 1.61: Domain d1prtk_: 1prt K:

Lineage for d1prtk_ (1prt K:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Pertussis toxin S4 subunit [50215] (1 species)

7. Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries)

8. Domain d1prtk_: 1prt K: [25131]
   Other proteins in same PDB: d1prta_, d1prtb1, d1prtb2, d1prtc1, d1prtc2, d1prtf_, d1prtg_, d1prth1, d1prth2, d1prti1, d1prti2, d1prtl_

Details for d1prtk_

PDB Entry: 1prt, 2.9 Å

PDB Description: the crystal structure of pertussis toxin

SCOP Domain Sequences for d1prtk_:

Sequence; same for both SEQRES and ATOM records:

>d1prtk_ b.40.2.1 (K:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp

Timeline for d1prtk_:

• d1prtk_ first appeared (with stable ids) in SCOP 1.55
  
• d1prtk_ appears in SCOP 1.59
  
• d1prtk_ appears in SCOP 1.63
  
• d1prtk_ appears in the current release, SCOPe 2.08