Lineage for d1prte_ (1prt E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) 
Protein Pertussis toxin S4 subunit [50215] (1 species) Species Bordetella pertussis [TaxId:520] [50216] (3 PDB entries) 
Domain d1prte_: 1prt E: [25129]
Other proteins in same PDB: d1prta_, d1prtb1, d1prtb2, d1prtc1, d1prtc2, d1prtf_, d1prtg_, d1prth1, d1prth2, d1prti1, d1prti2, d1prtl_
Details for d1prte_
PDB Entry: 1prt (more details), 2.9 Å
PDB Description: the crystal structure of pertussis toxin
SCOP Domain Sequences for d1prte_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1prte_ b.40.2.1 (E:) Pertussis toxin S4 subunit {Bordetella pertussis}
dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
SCOP Domain Coordinates for d1prte_:
Click to download the PDB-style file with coordinates for d1prte_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1prte_:
- d1prte_ appears in SCOP 1.57
- d1prte_ appears in the current release, SCOPe 2.08
View in 3D
