Lineage for d4bifb_ (4bif B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815203Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2815204Protein automated matches [190388] (30 species)
    not a true protein
  7. 2815253Species Granulicella tundricola [TaxId:1198114] [256205] (1 PDB entry)
  8. 2815255Domain d4bifb_: 4bif B: [251256]
    automated match to d2f4pb_
    complexed with mn

Details for d4bifb_

PDB Entry: 4bif (more details), 2.46 Å

PDB Description: Biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria
PDB Compounds: (B:) Cupin 2 conserved barrel domain protein

SCOPe Domain Sequences for d4bifb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bifb_ b.82.1.0 (B:) automated matches {Granulicella tundricola [TaxId: 1198114]}
meikrvgsqasgkgpadwftgtvridplfqapdpalvagasvtfepgartawhthplgqt
livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiqerldgkavdw
mehvtdeqyrr

SCOPe Domain Coordinates for d4bifb_:

Click to download the PDB-style file with coordinates for d4bifb_.
(The format of our PDB-style files is described here.)

Timeline for d4bifb_: