Lineage for d1bcpi1 (1bcp I:90-199)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228614Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 228800Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)
    N-terminal domain in S2/S3 has C-lectin-like fold
  7. 228801Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)
  8. 228809Domain d1bcpi1: 1bcp I:90-199 [25123]
    Other proteins in same PDB: d1bcpa_, d1bcpb2, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpf_, d1bcpg_, d1bcph2, d1bcpi2, d1bcpj_, d1bcpk_, d1bcpl_
    complexed with atp

Details for d1bcpi1

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp

SCOP Domain Sequences for d1bcpi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcpi1 b.40.2.1 (I:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis}
tiyktgqpaadhyyskvtatrllastnsrlcavfvrdgqsvigacaspyegryrdmydal
rrllymiymsglavrvhvskeeqyydyedatfqtyaltgislcnpaasic

SCOP Domain Coordinates for d1bcpi1:

Click to download the PDB-style file with coordinates for d1bcpi1.
(The format of our PDB-style files is described here.)

Timeline for d1bcpi1: