SCOPe 2.04: Domain d4be8a_: 4be8 A:

Lineage for d4be8a_ (4be8 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
   consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation

4. Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families)
   automatically mapped to Pfam PF00632

5. Family d.148.1.0: automated matches [227207] (1 protein)
   not a true family

6. Protein automated matches [226939] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225255] (8 PDB entries)

8. Domain d4be8a_: 4be8 A: [251225]
   automated match to d4bbna_

Details for d4be8a_

PDB Entry: 4be8, 3 Å

PDB Description: nedd4 hect a889f structure

PDB Compounds: (A:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d4be8a_:

Sequence; same for both SEQRES and ATOM records:

>d4be8a_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgsrdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwie
fdgekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsginpdhlsyfkf
igrvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteld
lrfiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegff
elipqdlikifdenelellmsglgdvdvndwrehtkykngysanhqviqwfwkavlmmds
ekrirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlppye
sfeelwdklqmfientqg

Timeline for d4be8a_:

• d4be8a_ is new in SCOPe 2.04-stable
  
• d4be8a_ appears in SCOPe 2.05
  
• d4be8a_ appears in the current release, SCOPe 2.08, called d4be8a1