Lineage for d4bd9b2 (4bd9 B:55-109)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032807Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 3032808Protein automated matches [190829] (14 species)
    not a true protein
  7. 3032894Species Sabellastarte magnifica [TaxId:389514] [256198] (1 PDB entry)
  8. 3032896Domain d4bd9b2: 4bd9 B:55-109 [251211]
    automated match to d4dtgk_
    complexed with zn

Details for d4bd9b2

PDB Entry: 4bd9 (more details), 2.2 Å

PDB Description: Structure of the complex between SmCI and human carboxypeptidase A4
PDB Compounds: (B:) carboxypeptidase inhibitor smci

SCOPe Domain Sequences for d4bd9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bd9b2 g.8.1.0 (B:55-109) automated matches {Sabellastarte magnifica [TaxId: 389514]}
gcnlpskvgpcrvsarmwfhnpetekcevfiyggchgnanrfatetecqevcdry

SCOPe Domain Coordinates for d4bd9b2:

Click to download the PDB-style file with coordinates for d4bd9b2.
(The format of our PDB-style files is described here.)

Timeline for d4bd9b2: