Lineage for d1bcpb1 (1bcp B:90-199)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788549Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)
    N-terminal domain in S2/S3 has C-lectin-like fold
  7. 2788550Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)
  8. 2788555Domain d1bcpb1: 1bcp B:90-199 [25120]
    Other proteins in same PDB: d1bcpa_, d1bcpb2, d1bcpc2, d1bcpd_, d1bcpe_, d1bcpf_, d1bcpg_, d1bcph2, d1bcpi2, d1bcpj_, d1bcpk_, d1bcpl_
    complexed with atp

Details for d1bcpb1

PDB Entry: 1bcp (more details), 2.7 Å

PDB Description: binary complex of pertussis toxin and atp
PDB Compounds: (B:) pertussis toxin

SCOPe Domain Sequences for d1bcpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcpb1 b.40.2.1 (B:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis [TaxId: 520]}
ttrntgqpatdhyysnvtatrllsstnsrlcavfvrsgqpvigactspydgkywsmysrl
rkmlyliyvagisvrvhvskeeqyydyedatfetyaltgisicnpgsslc

SCOPe Domain Coordinates for d1bcpb1:

Click to download the PDB-style file with coordinates for d1bcpb1.
(The format of our PDB-style files is described here.)

Timeline for d1bcpb1: