Lineage for d1prti1 (1prt I:90-199)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13784Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)
  7. 13785Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)
  8. 13789Domain d1prti1: 1prt I:90-199 [25119]
    Other proteins in same PDB: d1prta_, d1prtb2, d1prtc2, d1prtd_, d1prte_, d1prtf_, d1prtg_, d1prth2, d1prti2, d1prtj_, d1prtk_, d1prtl_

Details for d1prti1

PDB Entry: 1prt (more details), 2.9 Å

PDB Description: the crystal structure of pertussis toxin

SCOP Domain Sequences for d1prti1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prti1 b.40.2.1 (I:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis}
tiyktgqpaadhyyskvtatrllastnsrlcavfvrdgqsvigacaspyegryrdmydal
rrllymiymsglavrvhvskeeqyydyedatfqtyaltgislcnpaasic

SCOP Domain Coordinates for d1prti1:

Click to download the PDB-style file with coordinates for d1prti1.
(The format of our PDB-style files is described here.)

Timeline for d1prti1: