SCOP 1.55: Domain d1prth1: 1prt H:90-199

Lineage for d1prth1 (1prt H:90-199)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)

7. Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)

8. Domain d1prth1: 1prt H:90-199 [25118]
   Other proteins in same PDB: d1prta_, d1prtb2, d1prtc2, d1prtd_, d1prte_, d1prtf_, d1prtg_, d1prth2, d1prti2, d1prtj_, d1prtk_, d1prtl_

Details for d1prth1

PDB Entry: 1prt, 2.9 Å

PDB Description: the crystal structure of pertussis toxin

SCOP Domain Sequences for d1prth1:

Sequence; same for both SEQRES and ATOM records:

>d1prth1 b.40.2.1 (H:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis}
ttrntgqpatdhyysnvtatrllsstnsrlcavfvrsgqpvigactspydgkywsmysrl
rkmlyliyvagisvrvhvskeeqyydyedatfetyaltgisicnpgsslc

Timeline for d1prth1:

• d1prth1 appears in SCOP 1.57
  
• d1prth1 appears in the current release, SCOPe 2.08