Lineage for d4axoa_ (4axo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815203Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2815204Protein automated matches [190388] (30 species)
    not a true protein
  7. 2815228Species Clostridium difficile [TaxId:272563] [256193] (1 PDB entry)
  8. 2815229Domain d4axoa_: 4axo A: [251167]
    Other proteins in same PDB: d4axob2
    automated match to d2pytb_
    complexed with mg

Details for d4axoa_

PDB Entry: 4axo (more details), 1 Å

PDB Description: structure of the clostridium difficile eutq protein
PDB Compounds: (A:) ethanolamine utilization protein

SCOPe Domain Sequences for d4axoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4axoa_ b.82.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
dtvdfvrnkdisgitsiklptvkvsesdrldtgnpsdvvytkdlftleesprlgcgmmem
kettfdwtlnydeidyvidgtldiiidgrkvsassgelifipkgskiqfsvpdyarfiyv
typadw

SCOPe Domain Coordinates for d4axoa_:

Click to download the PDB-style file with coordinates for d4axoa_.
(The format of our PDB-style files is described here.)

Timeline for d4axoa_: