SCOPe 2.08: Domain d4axgb_: 4axg B:

Lineage for d4axgb_ (4axg B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries)

8. Domain d4axgb_: 4axg B: [251166]
   automated match to d1ipca_
   protein/RNA complex

Details for d4axgb_

PDB Entry: 4axg, 2.8 Å

PDB Description: Structure of eIF4E-Cup complex

PDB Compounds: (B:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d4axgb_:

Sequence, based on SEQRES records:

>d4axgb_ d.86.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvksiytl

Sequence, based on observed residues (ATOM records):

>d4axgb_ d.86.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylenmqneitsfdtvedfwslynhikppseiklgsdyslfkknirpmwe
daankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinirgksnkisi
wtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmnvksiytl

Timeline for d4axgb_:

• d4axgb_ first appeared in SCOPe 2.04
  
• d4axgb_ appears in SCOPe 2.07