Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (24 species) not a true protein |
Species Bacillus thuringiensis [TaxId:29339] [256191] (2 PDB entries) |
Domain d4aryb3: 4ary B:463-611 [251125] Other proteins in same PDB: d4arya1, d4arya2, d4aryb1, d4aryb2, d4aryc1, d4aryc2, d4aryd1, d4aryd2 automated match to d1ciya1 complexed with 13d, nga |
PDB Entry: 4ary (more details), 2.95 Å
SCOPe Domain Sequences for d4aryb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aryb3 b.18.1.0 (B:463-611) automated matches {Bacillus thuringiensis [TaxId: 29339]} nniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnrgyievpihfps tstryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfgyfesanaftss lgnivgvrnfsgtagviidrfefipvtat
Timeline for d4aryb3: