![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (45 species) not a true protein |
![]() | Species Bacillus thuringiensis [TaxId:29339] [256191] (2 PDB entries) |
![]() | Domain d4arya3: 4ary A:463-609 [251122] Other proteins in same PDB: d4arya1, d4arya2, d4aryb1, d4aryb2, d4aryc1, d4aryc2, d4aryd1, d4aryd2 automated match to d1ciya1 complexed with 13d, nga |
PDB Entry: 4ary (more details), 2.95 Å
SCOPe Domain Sequences for d4arya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4arya3 b.18.1.0 (A:463-609) automated matches {Bacillus thuringiensis [TaxId: 29339]} nniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnrgyievpihfps tstryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfgyfesanaftss lgnivgvrnfsgtagviidrfefipvt
Timeline for d4arya3: